SGTA (Small Glutamine-rich Tetratricopeptide Repeat-containing Protein alpha, Alpha-SGT, Vpu-binding protein, UBP, SGT, SGT1)

Größe

£685.00

SKU:: 133277
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa42-124 from human SGTA (NP_003012) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2E11
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: This gene encodes a protein which is capable of interacting with the major nonstructural protein of parvovirus H-1 and 70kD heat shock cognate protein; however, its function is not known. Since this transcript is expressed ubiquitously in various tissues, this protein may serve a housekeeping function. [provided by RefSeq]. Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AFGVTVEDSDLALPQTLPEIFEAAATGKEMPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPA* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.