SGK2 (Serine/Threonine-protein Kinase SGK2, Serum/Glucocorticoid-regulated Kinase 2)

Größe

£685.00

SKU:: 133264
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa293-367 from SGK2 (AAH65511) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4B12
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: SGK2, a Ser/Thr protein kinase, is similar to serum- and glucocorticoid-induced protein kinase (SGK), but this gene product is not induced by serum or glucocorticoids. Expression is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.