SGK071 (Probable Inactive Protein Kinase-like Protein SgK071, Sugen Kinase 071, C9orf96, MGC43306)

Größe

£685.00

SKU:: 133260
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1-100 from human C9orf96 (NP_714921) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B5
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: C9orf96 belongs to the serine/threonine protein kinase family. However, the protein kinase domain is predicted to be catalytically inactive. The specific function of this protein is unknown. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLGPGSNRRRPTQGERGPGSPGEPMEKYQVLYQLNPGALGVNLVVEEMETKVKHVIKQVECMDDHYASQALEELMPLLKLRHAHISVYQELFITWNGEI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.