133249-BIOTIN
SGCB (Beta-Sarcoglycan, Beta-SG, Sarcoglycan, beta, SGC, 43kD Dystrophin-associated Glycoprotein, 43DAG, A3b, LGMD2E) (Biotin)
Größe
£914.00
- SKU:
- 133249-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa87-196 from human SGCB with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1C10
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Beta-sarcoglycan is found in normal muscle but has a differential expression in certain instances of muscular dystrophy. This antibody will help identify the presence or absence of beta-sarcoglycan. Applications: Suitable for use in ELISA, Western Blot, Immunohistochemistry and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunohistochemistry: Formalin fixed paraffin embedded. Optimal dilutions to be determined by the researcher. AA Sequence: WAVIRIGPNGCDSMEFHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGNNQPIVFQQGTTKLSVENNKTSITSDIGMQFFDPRTQNILFSTDYETHEFHLPSGVK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice