SETD7 (SET Domain-containing Protein 7, SET7, Histone-lysine N-methyltransferase SETD7, Histone H3-K4 Methyltransferase SETD7, H3-K4-HMTase SETD7, KIAA1717, Lysine N-methyltransferase 7, KMT7, SET7/9, SET9)

Größe

£685.00

SKU:: 133209
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa257-367 from human SET7 (NP_085151) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 5B4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 0.5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SRDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAFQATQQK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.