133209-ML490
SETD7 (SET Domain-containing Protein 7, SET7, Histone-lysine N-methyltransferase SETD7, Histone H3-K4 Methyltransferase SETD7, H3-K4-HMTase SETD7, KIAA1717, Lysine N-methyltransferase 7, KMT7, SET7/9, SET9) (MaxLight 490)
Größe
£914.00
- SKU:
- 133209-ML490
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa257-367 from human SET7 (NP_085151) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 5B4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 0.5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SRDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAFQATQQK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice