133151-BIOTIN
Serotonin Receptor 5A (5-Hydroxytryptamine 5A Receptor, 5-Hydroxytryptamine Receptor 5A, 5-HT5A, 5-HT-5A, 5HT5A Receptor, 5-HT5A Receptor, 5-HT5AR, HTR5A, MGC138226) (Biotin)
Größe
£914.00
- SKU:
- 133151-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa223-282 from human HTR5A (NP_076917) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 10D3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- The histochemical antibody for 5-HT5A receptor is generated in a rabbit against synthetic peptide sequence corresponding to aa17-34 of the rat 5-HT5A receptor. The antibody produces 4+ (maximum) labeling of 5-HT5A receptor at dilutions of 1/100-1/300 using both indirect immunofluorescence and biotin-streptavidin/HRP technique in rat cortex and hippocampus. Optimal dilution will vary depending upon fixation, labeling technique and/or detection system; therefore, a dilution series is recommended. The antibody was characterized by immunoblotting and immunohistochemistry. Immunoblots of rat brain extracts revealed the presence of two bands at molecular weights of 41 and 47kD. The lower weight band agrees with the calculated molecular weight based on amino acid sequence. The higher weight may represent glycosylated receptor protein. Immunohistochemical staining of rat brain correlates well with Northern blot analysis and in situ hybridization studies. Immunolabeling is completely abolished by preadsorption with synthetic rat 5-HT5A receptor (17-34). BlastP database sequence homology searches indicate that the amino acid sequence is unique to rat and mouse 5-HT5A receptor. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: IYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQR Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice