Serotonin Receptor 2C (HTR2C, 5-hydroxytryptamine Receptor 2C, 5-HT-2C, 5-HT2C, 5-HTR2C, 5-hydroxytryptamine Receptor 1C, 5-HT-1C, 5-HT1C, HTR1C)

Größe

£685.00

SKU:: 133150
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-52 from human HTR2C (NP_000859) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1A8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: HTR2C is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPDGV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.