SERGEF (Secretion-regulating Guanine Nucleotide Exchange Factor, Deafness Locus-associated Putative Guanine Nucleotide Exchange Factor, DelGEF, Guanine Nucleotide Exchange Factor-related Protein, DELGEF, GNEFR)

Größe

£685.00

SKU:: 133149
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa240-338 from human DELGEF (NP_036271) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1A2
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Probable guanine nucleotide exchange factor (GEF), which may be involved in the secretion process. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KHGQLANEAAFLPVPQKIEAHCFQNEKVTAIWSGWTHLVAQTETGKMFTWGRADYGQLGRKLETYEGWKLEKQDSFLPCSRPPNSMPSSPHCLTGATE* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.