SENP5 (Sentrin-specific Protease 5, Sentrin/SUMO-specific Protease SENP5, SUMO1/sentrin Specific Peptidase 5, DKFZp564O1016, FKSG45, FLJ42398, MGC27076)

Größe

£685.00

SKU:: 133114
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa2-110 from human SENP5 (NP_689912) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3C2
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Covalent attachment of one protein to another is one of the more prominent posttranslational modifications in respect to size and ubiquity. Ubiquitin is the most familiar of the protein modifiers and its activation and transfer to target proteins has been studied extensively. Recently, a new group of ubiquitin-like proteins has been receiving a lot of attention. SUMO, or Sentrin, is one of the most intriguing. SUMO has been implicated in the stabilization of target proteins and/or their localization to sub-cellular complexes. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KKQRKILWRKGIHLAFSEKWNTGFGGFKKFYFHQHLCILKAKLGRPVTWNRQLRHFQGRKKALQIQKTWIKDEHLCAKTKFNVATQNVSTLSSKVKRKDAKHFISSSK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.