SEC14L2 (SEC14-like Protein 2, Alpha-tocopherol-associated Protein, TAP, hTAP, TAP1, C22orf6, KIAA1186, KIAA1658, Squalene Transfer Protein, Supernatant Protein Factor, SPF)

Größe

£685.00

SKU:: 133080
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa101-200 from SEC14L2 (NP_036561) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2E5
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution:: Optimal dilutions to be determined by the researcher. AA Sequence: DIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFP* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.