SEC13 (Protein SEC13 Homolog, SEC13-like Protein 1, SEC13-related Protein, D3S1231E, SEC13L1, SEC13R)

Größe

£685.00

SKU:: 133078
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa226-325 from human SEC13 (NP_109598) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1G7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Functions as a component of the nuclear pore complex (NPC) and the COPII coat. At the endoplasmic reticulum, SEC13 is involved in the biogenesis of COPII-coated vesicles. Applications: Suitable for use in ELISA and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNE* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.