SCNN1D (DNACH, Amiloride-sensitive Sodium Channel Subunit delta, Delta-NaCH, Epithelial Na(+) Channel Subunit delta, Nonvoltage-gated Sodium Channel 1 Subunit delta, SCNED, MGC149710, MGC149711)

Größe

£685.00

SKU:: 133032
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa432-531 from human SCNN1D (NP_002969) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2F3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: CFYRLYQDLETHRLPCTSRCPRPCRESAFKLSTGTSRWPSAKSAGWTLATLGEQGLPHQSHRQRSSLAKINIVYQELNYRSVEEAPVYSVPQLLSAMGS* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.