SCARB2 (Lysosome Membrane Protein 2, 85kD Lysosomal Membrane Sialoglycoprotein, LGP85, CD36 Antigen-like 2, Lysosome Membrane Protein II, LIMP II, Scavenger Receptor Class B Member 2, CD36, CD36L2, LIMPII)

Größe

£685.00

SKU:: 132994
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa339-437 from human SCARB2 (NP_005497) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1C8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Act as a lysosomal receptor for glucosylceramidase (GBA) targeting. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMINTTLIITN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.