132994-BIOTIN

SCARB2 (Lysosome Membrane Protein 2, 85kD Lysosomal Membrane Sialoglycoprotein, LGP85, CD36 Antigen-like 2, Lysosome Membrane Protein II, LIMP II, Scavenger Receptor Class B Member 2, CD36, CD36L2, LIMPII) (Biotin)

Größe

£914.00

SKU:: 132994-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa339-437 from human SCARB2 (NP_005497) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1C8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: Act as a lysosomal receptor for glucosylceramidase (GBA) targeting. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMINTTLIITN Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.