DSE (Dermatan-sulfate Epimerase, DS Epimerase, Chondroitin-glucuronate 5-epimerase, Squamous Cell Carcinoma Antigen Recognized by T-cells 2, SART2, SART-2)

Größe

£685.00

SKU:: 132978
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa574-674 from human SART2 (NP_037484) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6D4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: DSE is a tumor-rejection antigen. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunotherapy. This protein is localized to the endoplasmic reticulum. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GEESPLETAASFFHNVDVPFEETVVDGVHGAFIRQRDGLYKMYWMDDTGYSEKATFASVTYPRGYPYNGTNYVNVTMHLRSPITRAAYLFIGPSIDVQS* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.