132923
S100A4 (Protein S100-A4, Calvasculin, Metastasin, Placental Calcium-binding Protein, Protein Mts1, S100 Calcium-binding Protein A4, CAPL, MTS1)
Größe
£685.00
- SKU:
- 132923
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-102 from human S100A4 (AAH16300) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1F12-1G7
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- S100 calcium binding protein A4 (S100A4) is a member of the S100 family of calcium-binding proteins that contain two Ca(2+)-binding sites including a canonical EF-hand motif. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells. S100A4 interacts with cytoskeletal proteins and enhances metastasis of several types of cancer cells. It is secreted by unknown mechanisms, thus, paracrinely stimulating a variety of cellular responses, including angiogenesis and neuronal growth. S100A4 has been shown to be a prognostic marker in a number of human cancers, including esophageal-squamous cancers, non-small lung cancers, primary gastric cancers, malignant melanomas, prostate cancers, bladder cancers, and pancreatic carcinomas. The universality of S100A4 expression in a variety of cancers illustrates the potential use of S100A4 as a marker for tumor metastasis and disease progression. Applications: Suitable for use in ELISA, Western Blot and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunofluorescence: 15ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCDEFFEGFPDKQPRKK* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice