132923-ML490
S100A4 (Protein S100-A4, Calvasculin, Metastasin, Placental Calcium-binding Protein, Protein Mts1, S100 Calcium-binding Protein A4, CAPL, MTS1) (MaxLight 490)
Größe
£914.00
- SKU:
- 132923-ML490
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-102 from human S100A4 (AAH16300) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1F12-1G7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. S100 calcium binding protein A4 (S100A4) is a member of the S100 family of calcium-binding proteins that contain two Ca(2+)-binding sites including a canonical EF-hand motif. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells. S100A4 interacts with cytoskeletal proteins and enhances metastasis of several types of cancer cells. It is secreted by unknown mechanisms, thus, paracrinely stimulating a variety of cellular responses, including angiogenesis and neuronal growth. S100A4 has been shown to be a prognostic marker in a number of human cancers, including esophageal-squamous cancers, non-small lung cancers, primary gastric cancers, malignant melanomas, prostate cancers, bladder cancers, and pancreatic carcinomas. The universality of S100A4 expression in a variety of cancers illustrates the potential use of S100A4 as a marker for tumor metastasis and disease progression. Applications: Suitable for use in FLISA, Western Blot and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunofluorescence: 15ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCDEFFEGFPDKQPRKK* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice