132869-BIOTIN
RSL24D1 (C15orf15, Probable Ribosome Biogenesis Protein RLP24, Ribosomal L24 Domain-containing Protein 1, Ribosomal Protein L24-like, RPL24L, My024) (Biotin)
Größe
£914.00
- SKU:
- 132869-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-151 from human C15orf15 (AAH05344) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2A10-1E5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Involved in the biogenesis of the 60S ribosomal subunit. Ensures the docking of GTPBP4/NOG1 to pre-60S particles. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMV Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice