132866-HRP
RSK3, CT (Ribosomal S6 Kinase 3, RSK-3, pp90RSK3, 90kD Ribosomal Protein S6 Kinase 2, p90-RSK 2, p90RSK2, MAP Kinase-activated Protein Kinase 1c, MAPK-activated Protein Kinase 1c, MAPKAP Kinase 1c, MAPKAPK1C, MAPKAPK-1c, Ribosomal Protein S6 Kinase alpha-2, RPS6KA2, S6K-alpha-2, S6K-alpha2) (HRP)
Größe
£914.00
- SKU:
- 132866-HRP
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa631-733 from human RPS6KA2 (AAH02363) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1F6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Weitere Details:
- RSK3, a member of the S6 kinase subfamily of Ser/Thr protein kinases, phosphorylates a wide range of substrates including ribosomal protein S6. It is implicated in the activation of the mitogen-activated kinase cascade. This nuclear protein is expressed in many tissues, with highest expression in lung and skeletal muscle. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: YALSGGNWDSISDAAKDVVSKMLHVDPHQRLTAMQVLKHPWVVNREYLSPNQLSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTRL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice