132866-BIOTIN
RSK3, CT (Ribosomal S6 Kinase 3, RSK-3, pp90RSK3, 90kD Ribosomal Protein S6 Kinase 2, p90-RSK 2, p90RSK2, MAP Kinase-activated Protein Kinase 1c, MAPK-activated Protein Kinase 1c, MAPKAP Kinase 1c, MAPKAPK1C, MAPKAPK-1c, Ribosomal Protein S6 Kinase alpha-2, RPS6KA2, S6K-alpha-2, S6K-alpha2) (Biotin)
Größe
£914.00
- SKU:
- 132866-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa631-733 from human RPS6KA2 (AAH02363) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1F6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- RSK3, a member of the S6 kinase subfamily of Ser/Thr protein kinases, phosphorylates a wide range of substrates including ribosomal protein S6. It is implicated in the activation of the mitogen-activated kinase cascade. This nuclear protein is expressed in many tissues, with highest expression in lung and skeletal muscle. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: YALSGGNWDSISDAAKDVVSKMLHVDPHQRLTAMQVLKHPWVVNREYLSPNQLSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTRL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice