RSC1A1 (Regulatory Solute Carrier Protein Family 1 Member 1, Transporter Regulator RS1, hRS1)

Größe

£685.00

SKU:: 132861
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-101 from human RSC1A1 (NP_006502) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6F9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: RSC1A1 mediates transcriptional and post-transcriptional regulation of SLC5A1. The protein inhibits a dynamin and PKC-dependent exocytotic pathway of SLC5A1 and is also involved in transcriptional regulation of SLC22A2. It exhibits glucose-dependent, short-term inhibition of SLC5A1 and SLC22A2 by inhibiting the release of vesicles from the trans-Golgi network. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1.2ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MSSLPTSDGFNHPARSSGQSPDVGNPMSLARSVSASVCPIKPSDSDRIEPKAVKALKASAEFQLNSEKKEHLSLQDLSDHASSADHAPTDQSPAMPMQNS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.