RPSA (40S Ribosomal Protein SA, 37kD Laminin Receptor Precursor, 37LRP, 37/67kD Laminin Receptor, LRP/LR, 67kD Laminin Receptor, 67LR, Colon Carcinoma Laminin-binding Protein, Laminin Receptor 1, LamR, Laminin-binding Protein Precursor p40, LBP/p40, Multidrug Resistance-associated Protein MGr1-Ag, NEM/1CHD4, LAMBR, LAMR1)

Größe

£698.00

SKU:: 132834
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa196-295 from human RPSA (NP_002286) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 8G4
Format:: Supplied as a liquid in ascites fluid.
Weitere Details:: Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. Plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. May play a role in cell fate determination and tissue morphogenesis. Acts as a PPP1R16B-dependent substrate of PPP1CA. Also acts as a receptor for several other ligands, including the pathogenic prion protein, viruses, and bacteria. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EVMPDLYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSEGVQVPSVPIQQFPTEDWSAQPATEDWSAAPTAQATEWVGATTDWS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice