132828-BIOTIN
RPS6KB2 (Ribosomal Protein S6 Kinase beta 2, S6K-beta-2, S6K2, 70kD Ribosomal Protein S6 Kinase 2, p70-S6K 2, P70S6K2, p70 Ribosomal S6 Kinase beta, p70 S6 Kinase beta, p70 S6K-beta, p70 S6KB, S6K-beta, p70-beta, S6 Kinase-related Kinase, SRK, Serine/Threonine-protein Kinase 14B, STK14B) (Biotin)
Größe
£914.00
- SKU:
- 132828-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-100 from human RPS6KB2 (AAH06106) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4B11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Phosphorylates specifically ribosomal protein S6. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHSFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKV Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice