RPP40 (Ribonuclease P Protein Subunit p40, RNaseP Protein p40, RNase P Subunit 1, RNASEP1)

Größe

£685.00

SKU:: 132802
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa295-363 from human RPP40 (NP_006629) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1G8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit for recombinant GST tagged RPP40 is 0.1ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: EHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKNEHGFRKGGEHLYNFVIFNNQDYWLQMAVGANDHCPP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.