RPP40 (Ribonuclease P Protein Subunit p40, RNaseP Protein p40, RNase P Subunit 1, RNASEP1)

Größe

£685.00

SKU:: 132801
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full-length human RPP40, aa1-244 (AAH17871.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MNTGPYYFVKNLPLHELITPEFISTFIKKGKLILSLDKDTYEETGLQGHPSQFSGRKIMKFIVSIDLMELSLNLDSKKYERISWSFKEKKPLKFDFLLAWHKTGSEESTMMSYFSKYQIQEHQPKVALSTLRDLQCPVLQSSELEGTPEVSCRALELFDWLGAVFSNVDLNNEPNNFISTYCCPEPSTVVAKAYLCTITGFILPEKICLLLEHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.