MST4 (Mammalian STE20-like Protein Kinase 4, MST-4, Serine/threonine-protein Kinase MST4, STE20-like Kinase MST4, Mst3 and SOK1-related Kinase, MASK, Serine/threonine-protein Kinase MASK, RP6-213H19.1)

Größe

£685.00

SKU:: 132748
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-138 from human RP6-213H19.1 (AAH17213) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2G6
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRALPPYERSLIQRKYRMGQSKILCKP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.