132728-BIOTIN
ROR1 (Tyrosine-protein Kinase Transmembrane Receptor ROR1, Neurotrophic Tyrosine Kinase, Receptor-related 1, NTRKR1, MGC99659) (Biotin)
Größe
£914.00
- SKU:
- 132728-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa294-393 from human ROR1 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1B4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- ROR1 belongs to the ROR family of receptor tyrosine kinases, which are characterized by: the extracellular immunoglobulin domain, a cysteine-rich domain that resembles the Wnt binding sites of Frizzled proteins, a kringle domain and an intracellular kinase domain. Human ROR1 shares 97-58aa sequence identity with mouse ROR1 and human ROR2, respectively. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACGK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice