RON (p185-Ron, CDW136, CD136, MST1R, Macrophage-stimulating Protein Receptor alpha Chain, Macrophage-stimulating Protein Receptor beta Chain, Macrophage-stimulating Protein Receptor MSPR, MSP Receptor, Protein-tyrosine Kinase 8, PTK8)

Größe

£685.00

SKU:: 132724
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa26-125 from human MST1R (NP_002438) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4E2
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Macrophage stimulating protein receptor, encoded by the human RON and the mouse Stk genes, is one of a family of receptor tyrosine kinases that also includes human Met. This family of receptors is synthesized as a single-chain precursor that is cleaved into a mature disulfide-linked heterodimer composed of an extracellular a chain and a membrane spanning b chain with intrinsic tyrosine kinase activity. Expression of MSP R is restricted to specific areas of the central and peripheral nervous systems, epithelial cells along the digestive tract, skin and lung, and in subpopulations of the mononuclear phagocyte lineage. Both the MSP heterodimer and the free MSP b chain have been shown to bind MSP R. However, only the MSP heterodimer can induce receptor dimerization and phosphorylation and cause biological activity. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice