ROD1 (PTBP3, Polypyrimidine Tract-binding Protein 3, Regulator of Differentiation 1)

Größe

£685.00

SKU:: 132722
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa16-114 from ROD1 (NP_005147) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4C9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: RNA-binding protein that mediates pre-mRNA alternative splicing regulation. Plays a role in the regulation of cell proliferation, differentiation and migration. Positive regulator of EPO-dependent erythropoiesis. Participates in cell differentiation regulation by repressing tissue-specific exons. Promotes FAS exon 6 skipping. Binds RNA, preferentially to both poly(G) and poly(U). Applications: Suitable for use in ELISA, Immunofluorescence, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 20ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: GSDELLSSGIINGPFTMNSSTPSTANGNDSKKFKRDRPPCSPSRVLHLRKIPCDVTEAEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.