132720-ML490
ROCK1 (Rho-associated Protein Kinase 1, Renal Carcinoma Antigen NY-REN-35, Rho-associated, Coiled-coil-containing Protein Kinase 1, Rho-associated, Coiled-coil-containing Protein Kinase I, ROCK-I, p160 ROCK-1, p160ROCK, MGC131603, MGC43611) (MaxLight 490)
Größe
£914.00
- SKU:
- 132720-ML490
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa401-511, from human ROCK1 (NP_005397) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2E2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. ROCK-1 (Rho-associated coiled coil-containing protein kinase 1) has been found to be a new caspase-3 substrate. ROCK-1 consists of an amino-terminal kinase domain and an inhibitory cysteine/histidine-rich C-terminal domain. During apoptosis, ROCK-1 is cleaved by caspase-3 at the conserved DETD1113/G sequence and its C-terminal inhibitory domain is removed, resulting in deregulated and constitutive kinase activity. The caspase-3 mediated cleavage and activation of ROCK-1 induces phosphorylation of MLC and membrane blebbing, the early events in the execution phase of apoptosis. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SNRRYLSSANPNDNRTSSNADKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLESTVSQIEKEKMLLQHRINEYQRKAEQENEKRR Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice