132720-BIOTIN
ROCK1 (Rho-associated Protein Kinase 1, Renal Carcinoma Antigen NY-REN-35, Rho-associated, Coiled-coil-containing Protein Kinase 1, Rho-associated, Coiled-coil-containing Protein Kinase I, ROCK-I, p160 ROCK-1, p160ROCK, MGC131603, MGC43611) (Biotin)
Größe
£914.00
- SKU:
- 132720-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa401-511, from human ROCK1 (NP_005397) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2E2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- ROCK-1 (Rho-associated coiled coil-containing protein kinase 1) has been found to be a new caspase-3 substrate. ROCK-1 consists of an amino-terminal kinase domain and an inhibitory cysteine/histidine-rich C-terminal domain. During apoptosis, ROCK-1 is cleaved by caspase-3 at the conserved DETD1113/G sequence and its C-terminal inhibitory domain is removed, resulting in deregulated and constitutive kinase activity. The caspase-3 mediated cleavage and activation of ROCK-1 induces phosphorylation of MLC and membrane blebbing, the early events in the execution phase of apoptosis. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SNRRYLSSANPNDNRTSSNADKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLESTVSQIEKEKMLLQHRINEYQRKAEQENEKRR Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice