132715-APC
ROBO1 (Roundabout Homolog 1, Deleted in U Twenty Twenty, H-Robo-1, DUTT1) (APC)
Größe
£927.00
- SKU:
- 132715-APC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa491-590, from human ROBO1 (NP_002932) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2G6
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Weitere Details:
- Roundabout Homolog 1 (ROBO1) is a type I transmembrane protein belonging to the ROBO family, which defines a novel subfamily of immunoglobulin superfamily proteins. ROBO family proteins are evolutionarily conserved receptors that interact with the secreted Slit proteins. ROBO-Slit interactions play an important role in axon guidance across the midline during central nervous system development. ROBO signaling also has a role in tumor angiogenesis and immune responses. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGA Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice