RNF148 (Ring Finger Protein 148, MGC35222)

Größe

£685.00

SKU:: 132662
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa139-239 from human RNF148 (NP_932351) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2D3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: RNF148 contains one PA (protease associated) domain and one RING-type zinc finger. The exact function of RNF148 remains unknown. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: VFPMSHQGTENIVAVMISNLKGMEILHSIQKGVYVTVIIEVGRMHMQWVSHYIMYLFTFLAATIAYFYLDCVWRLTPRVPNSFTRRRSQIKTDVKKAIDQ* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.