RNASE2 (Non-secretory Ribonuclease, Eosinophil-derived Neurotoxin, RNase UpI-2, Ribonuclease 2, RNase 2, Ribonuclease US, EDN, RNS2)

Größe

£685.00

SKU:: 132616
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full-length protein corresponding to aa1-161 from human RNASE2.
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Eosinophil derived neurotoxin (EDN) is a protein belonging to the ribonuclease (RNase) A superfamily. It has recently been found to have antiviral activity against respiratory syncytial virus and human immunodeficiency virus in vitro. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MVPKLFTSQICLLLLLGLLAVEGSLHVKPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.