132605-ML650
RIT2 (RIN, ROC2, GTP-binding Protein Rit2, Ras-like Protein Expressed in Neurons, Ras-like Without CAAX Protein 2) (MaxLight 650)
Größe
£914.00
- SKU:
- 132605-ML650
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to human RIT2, aa1-218 (AAH18060) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3F2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Weitere Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. GTP-binding protein Rit2 (Rit2; also Rin, Ras-like protein expressed in neurons, Ras-like without CAAX) is a 25kD member of the small GTPase superfamily and Ras family. Human Rit2 is 217aa in length. Like all small G-proteins, Rit2 contains five highly conserved domains (G1-G5) and acts as a molecular switch by alternating an active GTP-bound form and an inactive GDP-bound form. There are two isoforms for Rit2. Isoform 1 is the long form. Isoform 2 has an 11aa substitution for residues 143-153 found in isoform 1 and a deletion of aa154-217. Rit2 is expressed exclusively in neurons. In addition, Rit2 binds calmodulin through a C-terminal binding motif. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVREIRKKESMPSLMEKKLKRKDCLWKKLKGSLKKKRENMT Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice