RIPK5 (Dual Serine/Threonine And Tyrosine Protein Kinase, Receptor-interacting Serine/Threonine-protein Kinase 5, Dusty Protein Kinase, Dusty PK, RIP-homologous Kinase, Sugen Kinase 496, DSTYK, KIAA0472, RIP5, SGK496, RIPK5, HDCMD38P)

Größe

£685.00

SKU:: 132603
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa80-190 from RIPK5 (NP_056190) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4F3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: This gene encodes a dual serine/threonine and tyrosine protein kinase which is expressed in multiple tissues. Multiple alternatively spliced transcript variants have been found, but the biological validity of some variants has not been determined. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DVAETGLQAGQLSCISFPPKEEKYLQQIVDCLPCILILGQDCNVKCQLLNLLLGVQVLPTTKLGSEESCKLRRLRFTYGTQTRVSLALPGQYELVHTLVAHQGNWETIPE* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.