RIPK2 (Receptor-interacting Serine/Threonine Protein Kinase 2, RIP-like Interacting CLARP Kinase, Receptor-interacting Protein 2, RIP-2, CARD-containing Interleukin-1 beta Converting Enzyme Associated Kinase, CARD-containing IL-1 beta ICE-kinase, RIPK2, CARDIAK, RIP2, UNQ277/PRO314/PRO34092)

Größe

£685.00

SKU:: 132601
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa431-541 from RIPK2 (AAH04553) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2C7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: RIPK2 is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.