132584
RIN1 (Ras and Rab Interactor 1, Ras Interaction/Interference Protein 1, Ras Inhibitor JC99)
Größe
£685.00
- SKU:
- 132584
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa646-755 from RIN1 (AAH14417) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1D11
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- RIN1 (Ras and Rab interactor 1 or Ras interaction:interference 1) is identified as a Ras effector protein based on its ability to block Ras induced cell death. The protein binds GTP-Ras, Bcr-Abl, and 14-3-3. It is composed of several functional domains: SH2 and proline-rich domains in the N-terminal region and Vps9 and Ras association domains in the C-terminal region. Recent studies have shown that through its interaction with Abl tyrosine kinase, RIN1 mediates actin cytoskeleton remodeling associated with migration and adhesion of epithelial cells. The protein also regulates EGF-induced signal transduction. It is highly expressed in brain, placenta and pancreas. Human RIN1 gene is localized in the chromosomal region 11q13.1. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VPPEASIATLNQLCATKFRVTQPNTFGLFLYKEQGYHRLPPGALAHRLPTTGYLVYRRAEWPETQGAVTEEEGSGQSEARSRGEEQGCQGDGDAGVKASPRDIREQSETT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice