132565-ML650
RHOQ (TC10, ARHQ, RASL7A, Rho-related GTP-binding Protein RhoQ, Ras-like Protein TC10, Ras-like Protein Family Member 7A) (MaxLight 650)
Größe
£914.00
- SKU:
- 132565-ML650
- Anwendung:
- FLISA
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa106-205 from RHOQ (NP_036381) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2C1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Weitere Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. TC10 is a member of the Rho family of GTP-binding proteins and is closely related to Cdc42 and Rac 1. Cycling between inactive and active GTP-bound state, active TC10 can directly interact with Cdc42 kinase, p21-activated protein kinases as well as other kinases. Constitutive expression of active TC10 mutants (TC10/Q75L) in fibroblast decrease actin stress fiber and formation of plasma membrane microspikes, while wild type TC10 has no effect on fibroblast cell morphology. Mostly expressed in adipose and muscle tissues, TC10 has been found to be activated by C3G (from the insulin pathway) in adipocytes. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCCLI* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice