RHOBTB3 (Rho-related BTB Domain-containing Protein 3, KIAA0878)

Größe

£685.00

SKU:: 132558
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-100 from RHOBTB3 (NP_055714) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3A10
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: RHOBTB3 is a member of the evolutionarily conserved RHOBTB subfamily of Rho GTPases. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSIHIVALGNEGDTFHQDNRPSGLIRTYLGRSPLVSGDESSLLLNAASTVARPVFTEYQASAFGNVKLVVHDCPVWDIFDSDWYTSRNLIGGADIIVIK* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.