RGS4 (Regulator of G-Protein Signaling 4, Regulator of G-Protein Signalling 4, RGS-4, MGC2124, MGC60244, RGP4, SCZD9)

Größe

£685.00

SKU:: 132537
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to human RGS4, aa1-206 (AAH51869) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B2
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: RGS signaling proteins are highly diverse and multifunctional proteins acting as inhibitors of G-protein signaling. They function as GTPase activating proteins (GAPs) for G-alpha sub-units of heterotrimeric G proteins and drive G proteins into their inactive GDP-bound forms. RGS4 is a member of B/R4 sub-family of these proteins and consists of a highly conserved RGS domain. It plays a crucial role in regulating G-protein signaling, IP3-mediated Ca2+ signaling and relaxation of G-protein gated potassium channels. Located both in the cytosol and membrane-bound, it acts as a multifunctional scaffold protein and blocks G i/o-mediated signaling in mammalian cells. RGS4 selectively binds to PIP3 and blocks Gq/11-directed inositol lipid/Ca2+ signaling. It is regulated by post-translational modifications which include palmitoylation and phosphorylation of RGS domain. Role of RGS4 has been implicated in Schizophrenia and chronic heart failure. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice