132530
RGS20 (Regulator of G-protein Signaling 20, Gz-selective GTPase-activating Protein, G(z)GAP, Gz-GAP, Regulator of G-protein Signaling Z1, Regulator of Gz-selective Protein Signaling 1, RGSZ1, ZGAP1) (Not for Export EU)
Größe
£760.00
- SKU:
- 132530
- Reinheit:
- Serum
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human RGS20, aa1-241 (NP_003693.2).
- Format:
- Supplied as a liquid.
- Weitere Details:
- RGS proteins are regulatory and structural components GPCR complexes. These are GAPs for Gi and Gq class G-alpha proteins and negatively regulate GPCR signaling pathways. RGS20, a 25kD protein, is a novel member of this family and is human homolog of bovine Gz-GAP. It contains an N-terminal cysteine string that is potential site for multiple palmitoylation and a C-terminal RGS core domain. RGS20 plays a vital role in regulating GPCR signals in brain, neuronal development and regulation of golgi structure. It specifically interacts and accelerates the hydrolysis of G-alphaz. Reports suggest that it interacts with G-alphai subunit and plays a significant role in regulation of G-alphai-mediated signaling. It is a membrane-bound protein specifically expressed in brain, with highest concentrations in caudate nucleus and temporal lobe. Applications: Suitable for use in Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRTADGGEPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice