132527
RGS18 (Regulator Of G-Protein Signaling 18, RGS13)
Größe
£698.00
- SKU:
- 132527
- Reinheit:
- Ascites
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-236 from RGS18 (AAH20632) with GST tag.
- Klon:
- 1H6
- Format:
- Supplied as a liquid in ascites fluid.
- Weitere Details:
- Regulator of G-protein signaling 18; RGS13, RGS signaling proteins are highly diverse and multifunctional proteins that act as inhibitors of G-protein signaling. RGS18, a 235aa protein, is the smallest member of this family. It is predominantly expressed in immune tissues and is characterized by the presence of a conserved 120A.A RGS domain. It is found to be expressed in lymphocytes, megakaryocytes and platelets and might play an important role in regulating G-protein mediated signaling in lungs and immune system. It specifically binds to GTP-bound G-alpha subunits and acts as a GAP protein, thus inhibiting G-alpha mediated signaling. It blocks MAP-Kinase activity and cAMP generation induced by G-alpha-i or G-alpha-q-coupled receptors. This protein is thought to play an important role in proliferation, differentiation and migration of megakaryocytes and platelets. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: METTLLFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHEDTRSSRSGHLAKETRVSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYEKFIQTDAPKEVNLDFHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNEFQDVQSDVAIWL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice