132498-BIOTIN
RFNG (Beta-1,3-N-acetylglucosaminyltransferase Radical Fringe, O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase) (Biotin)
Größe
£914.00
- SKU:
- 132498-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa82-191, from human RFNG, from with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 6C7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- The Drosophila melanogaster 'fringe' gene is a secreted signaling protein that is involved in the formation of boundaries between groups of cells during development. It acts by modulating the activation of te Notch signal transduction pathway. A human radical fringe homolog was identified in 1997. There is evidence to show that radical fringe homolog may be involve in limb formation and in neurogenesis in humans. It is a glycosyltransferase that initiates the elongation of O-linked fucose residues attached to EGF-like repeats in the extracellular domain of Notch molecules. It is a single-pass type II membrane protein which localises to the golgi apparatus membrane. It belongs to the glycosyltransferase 31 family. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: LGSFMSTAEQVRLPDDCTVGYIVEGLLGARLLHSPLFHSHLENLQRLPPDTLLQQVTLSHGGPENPQNVVNVAGGFSLHQDPTRFKSIHCLLYPDTDWCPRQKQGAPTS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice