RFC3 (Replication Factor C Subunit 3, Activator 1 Subunit 3, Replication Factor C 38kD Subunit, RF-C 38kD Subunit, RFC38, Activator 1 38kD Subunit, A1 38kD Subunit, MGC5276)

Größe

£685.00

SKU:: 132491
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa257-356, from human RFC3 (AAH00149) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1C6
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36kD. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.