Resistin (RETN, RSTN, Adipose Tissue-specific Secretory Factor, ADSF, C/EBP-epsilon-regulated Myeloid-specific Secreted Cysteine-rich Protein, Cysteine-rich Secreted Protein A12-alpha-like 2, Cysteine-rich Secreted Protein FIZZ3, FIZZ3, HXCP1, RETN1, XCP1, UNQ407/PRO1199)

Größe

£760.00

SKU:: 132482
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Full length human RETN, aa1-108 (AAI01555.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.