Resistin (RETN, RSTN, Adipose Tissue-specific Secretory Factor, ADSF, C/EBP-epsilon-regulated Myeloid-specific Secreted Cysteine-rich Protein, Cysteine-rich Secreted Protein A12-alpha-like 2, Cysteine-rich Secreted Protein FIZZ3, FIZZ3, HXCP1, RETN1, XCP1, UNQ407/PRO1199) (PE)

Größe

£934.00

SKU:: 132482-PE
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Full length human RETN, aa1-108 (AAI01555.1).
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Weitere Details:: Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.