REEP5 (C5orf18, DP1, TB2, Receptor Expression-enhancing Protein 5, Polyposis Locus Protein 1, Protein TB2, MGC70440)

Größe

£685.00

SKU:: 132462
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa113-185 from C5orf18 (NP_005660) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3G11
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: REEP5 may promote functional cell surface expression of olfactory receptors. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKS* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.