RCE1 (CAAX Prenyl Protease 2, Prenyl Protein-specific Endoprotease 2, Farnesylated Proteins-converting Enzyme 2, FACE-2, RCE1 Homolog, hRCE1, FACE2, RCE1A, RCE1B)

Größe

£685.00

SKU:: 132432
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa133-182 from RCE1 (NP_005124) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6A6
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: RCE1 is an integral membrane protein which is classified as a member of the metalloproteinase family. This enzyme is thought to function in the maintenance and processing of CAAX-type prenylated proteins. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRAC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.